SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022629 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022629
Domain Number 1 Region: 31-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 2 Region: 94-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000105
Family Fibronectin type I module 0.023
Further Details:      
 
Domain Number 3 Region: 195-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000811
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022629   Gene: ENSORLG00000018064   Transcript: ENSORLT00000022630
Sequence length 348
Comment pep:known_by_projection chromosome:MEDAKA1:24:22910987:22912966:1 gene:ENSORLG00000018064 transcript:ENSORLT00000022630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLSGGGSANFKCHVFLFVCEPPAAGQECSGQCSCPSAPPRCPPGVSLVLDGCGCCRVCA
KQMGELCTDKDVCDPHKNLFCDIGAPISRRIGVCTAREGASCVFGGTVYKSGETFQSSCK
YQCTCMDGAMGCVPLCSMDIRLPSPDCPMPRRVKVPGKCCEEWECDSPYKDTLLGPALSA
FREEETYGPDPNMMRENCLVQTTEWSACSKTCGLGISTRVTNDNHECRLEKQTRLCMVRP
CESQMEQSIKKGKKCIRTPRVSKPMKFEISGCTTTKSYRPKFCGVCLDGRCCTPHRTTTL
PMEFKCPDGQVMKKHMMFIKSCACHYNCPGENDIFEAMYYKKMTGDTV
Download sequence
Identical sequences H2MV06
ENSORLP00000022629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]