SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022630 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022630
Domain Number 1 Region: 36-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000942
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 2 Region: 99-171
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000398
Family Fibronectin type I module 0.023
Further Details:      
 
Domain Number 3 Region: 200-246
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000837
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022630   Gene: ENSORLG00000018064   Transcript: ENSORLT00000022631
Sequence length 353
Comment pep:known_by_projection chromosome:MEDAKA1:24:22911353:22912966:1 gene:ENSORLG00000018064 transcript:ENSORLT00000022631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYSKEEKMFANKEKVIWLPLLCLIYSYAAAGQECSGQCSCPSAPPRCPPGVSLVLDGCGC
CRVCAKQMGELCTDKDVCDPHKNLFCDIGAPISRRIGVCTAREGASCVFGGTVYKSGETF
QSSCKYQCTCMDGAMGCVPLCSMDIRLPSPDCPMPRRVKVPGKCCEEWECDSPYKDTLLG
PALSAFREEETYGPDPNMMRENCLVQTTEWSACSKTCGLGISTRVTNDNHECRLEKQTRL
CMVRPCESQMEQSIKKGKKCIRTPRVSKPMKFEISGCTTTKSYRPKFCGVCLDGRCCTPH
RTTTLPMEFKCPDGQVMKKHMMFIKSCACHYNCPGENDIFEAMYYKKMTGDTV
Download sequence
Identical sequences H2MV07
ENSORLP00000022630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]