SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022641 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022641
Domain Number 1 Region: 284-517
Classification Level Classification E-value
Superfamily HCP-like 1.22e-49
Family HCP-like 0.00014
Further Details:      
 
Domain Number 2 Region: 491-625
Classification Level Classification E-value
Superfamily HCP-like 3.27e-26
Family HCP-like 0.0049
Further Details:      
 
Domain Number 3 Region: 130-249
Classification Level Classification E-value
Superfamily HCP-like 9.16e-22
Family HCP-like 0.0065
Further Details:      
 
Domain Number 4 Region: 43-95
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-21
Family Fibronectin type II module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022641   Gene: ENSORLG00000018072   Transcript: ENSORLT00000022642
Sequence length 720
Comment pep:known_by_projection chromosome:MEDAKA1:24:22930027:22938698:-1 gene:ENSORLG00000018072 transcript:ENSORLT00000022642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSSPSHPEENKLSSVEGVEEESLPDPPAPVKDKVKEVPVVNGGTAHGEPCLFPFSFQG
REYSDCTTDGRRDGRLWCATTYDYDADKKWGFCETEEQVQQRLQAEEAEEEYQSVLRMLN
GTSRKAQKRELYEKLLKITEKGHQKATEKVAYAMLFGDYINQNVTKAKELFEKLAIDGSP
KAQMALGFLYAAGLGVNSSQAKALVYYTFGALGGNLLAHMILGYRYWAGVGVPQSCESAL
THYRLVANQVANDVSLTGGSAVQRIRLLDEVENPGSTSGMLEEDLIQYYQFLAEKGDVQA
QVGLGQLHLHGGRGVEQNHQRAFDYFTQAANAGNTHAMAFLGKMYSEGSAFLPQNNETAL
QYFKKASDLGNPVGQSGLGMAYLYGRGVPVNYELALKYFQKAAEQGWVDGQLQLGTMYYN
GIGVKRDYKQALKFFNLASQAGHILAFYNLAQMHATGTGVMRSCHTAVELFKNVCERGRW
SERLMTAYSSFKEGDAESALVQYLLLAEQGYEVAQSNVAFLLEQKGAKMFSENETYPRAL
LHWTRAAAQGYTVARIKLGDYHFYGFGTDVDYETAVIHYRLASEQQNGAQAMFNLGYMHE
KGLGIKRDIHLAKRFYDMAAEASPDAQVPVFLALCKLGLVYTLQYLQDLNVKEVITQVDL
DQLLGPEWDLYLMTVIALLLGTVIAYRQRQHQIILPAAPAVVQDQPPAQAMDGAQEETPA
Download sequence
Identical sequences H2MV17
ENSORLP00000022641 ENSORLP00000022641 8090.ENSORLP00000022641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]