SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022751 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022751
Domain Number 1 Region: 20-161
Classification Level Classification E-value
Superfamily Activator of Hsp90 ATPase, Aha1 4.84e-41
Family Activator of Hsp90 ATPase, Aha1 0.002
Further Details:      
 
Domain Number 2 Region: 211-337
Classification Level Classification E-value
Superfamily Bet v1-like 1.47e-24
Family AHSA1 domain 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022751   Gene: ENSORLG00000018168   Transcript: ENSORLT00000022752
Sequence length 338
Comment pep:known_by_projection chromosome:MEDAKA1:24:24012399:24015092:1 gene:ENSORLG00000018168 transcript:ENSORLT00000022752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWGEGDPRWIVEERADATNVNNWHWTERDVSAWSSDRLRQLLLSIRVEGPEGVCLMTE
VSKLDGEASINNRKGKLFFFYEWQLKASWLGTSVGGVKYRGTVEVSNLSDENDEDDLDIN
VSLCKDQPNTPLLDLMKRTGVKEVRRVLTKYVQDLKSEFSQGMILPTADGKDPSVPAKAK
RNFVKTRTQITPSQKSLSSPTQTSTGVLIPTCGFNLQESFRTSAEELYETFINQEFVQVF
TRLPAAVDSRKGGKFWHLDGSVHGEFTELVPHQRIHMKWRFRTWPSEHFAAVSLELEDHG
DETELRMECRGVPAGQEGSTEEGWKRFYFNAIKQAFGY
Download sequence
Identical sequences H2MVC1
8090.ENSORLP00000022751 XP_004083998.1.28442 ENSORLP00000022751 ENSORLP00000022751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]