SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023051 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023051
Domain Number 1 Region: 25-501
Classification Level Classification E-value
Superfamily Sema domain 4.71e-118
Family Sema domain 0.000041
Further Details:      
 
Domain Number 2 Region: 1338-1467,1661-1850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 850-947
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000916
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 4 Region: 1033-1136
Classification Level Classification E-value
Superfamily E set domains 0.000000000000154
Family E-set domains of sugar-utilizing enzymes 0.071
Further Details:      
 
Domain Number 5 Region: 504-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000445
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1153-1221
Classification Level Classification E-value
Superfamily E set domains 0.0000106
Family Other IPT/TIG domains 0.043
Further Details:      
 
Domain Number 7 Region: 802-838
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000628
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023051   Gene: ENSORLG00000018412   Transcript: ENSORLT00000023052
Sequence length 1880
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig90:355648:420954:1 gene:ENSORLG00000018412 transcript:ENSORLT00000023052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSLPLYEFFLSALISGSGRAVYRVFNTSLTHLTIHRRTGEVFVGAVNRVIKLSPNLTEL
KSHETGPVEDNDMCYPPPSMRNCAHGLVNLDNVNKLLLVDYTGNRLVACGSIWQGVCQFL
RLEDLFKLGEPHHRKEHYLSGAREADGMAGVVVDEDDWISDPAKKKPVKGSSRLFIGAAI
DGKSEYFPTLSSRKLVADEENMDMFSLVYQDEFVSSQIKIPSDTLSTYPAFDIYYIYGFS
SRTYVYFLTLQLDTQLTQMDAGGEKFFTSKIVRLCSNDTLFYSYVEFPLGCTKDGVEYRL
VQAAYKQKPGRRLAQALGLSEDDDILFVVFSQGQKNRSNPPRETVLCLFTLYNINMAIRE
KIHSCYRGEGKLSLSWLLNRELNCIPTPHQIGDDFCGLVLNQPLGGLRVIEGFPLYEDRT
EGMGAVAGYTYGEHTVVFVGTRSGQLKKIRVDGIPPPTQNALLYETVPVVEGKPILRDMV
FSPDHQHIYLLSDRQVSKLPVESCDQYSSCPDCLGSGDPHCGWCVLFNKCSRKEACSRWE
EPQHFNTRLDQCVHISVSPSNMSVTSPPTQLSVQMQNVPALSGGVSCVFEDLTETLGEVL
SKGQVKCTLPSFRDLPSDSHTHEEKRVVQLSLRSKETGLQFISTTIVYYNCSVLSSCTSC
VSSLFPCHWCKYRHICTNNLQDCSFQEGRVSNMEGCPQILPNTDILVPAGMVRPITLRAR
NLPQPQSGQKNYECVFSIQGKVQRIPAVRYNSSCIQCQNTSYWYDGDEAGDLPVDFSVVW
DGDFLIDKPAFMKALLYKCEAQRSSCGQCLKAPTAFECGWCTESRKCLLRQHCPSPEQNW
MHHGRHNLRCSHPRITRIDPLTGPREGGTRVTIEGENLGLQVKEIAQVQVAGVRCNPVPV
QYISAERIVCDMTEALLPHSLGGPVEVCIGVCSTEYRTTSTQIYSFVKETFERISQLRVG
AADPLALQRAASCLVGSCLTTNYQYSKELFSNSQKHKXVCITPASVSGTGSASIRLMIDR
AEVTSLEVKYTYTEDPTITSVEPNWTILNGSTMITVMGTNLYTIQEPKVRAKYGGLETTN
FCTLVNDSAMTCLAPGLVYNKPEPPDGALQPDEFGFIFDQVSSLLVLNSTPFMHYPNPTF
DPLGNAGVLEVTPGSPIIIKGKNLIPGNNRLNYTVLIGESPCVLTVSESQLLCDSPDLTG
EQRVLILVGGLEYSPGMLHIYSNSVLTLPAIIGIGAGGGVLLIAIIAVLIAYKRKTRDAD
RTLKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEYRTYTMRVMFPG
IEEHPVLKELDSPANVEKALRLFSQLLNNKMFLLTFIHTLEAQRSFSMRDRGNVASLLMA
ALQGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRRTESVAEKMLTNWFTFLLHRFLKE
CAGEPLFMLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAG
TEVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTT
KIESDWKRLNTLAHYQVTDGSVVALVQKQVSAYNIANSFTFTRSLSRYESLLRTSSSPDS
LRSRAPMITPDQETGTKLWHLVKNHEHDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDD
LFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKN
PQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERY
YRDITKMPSISDQDMDAYLVEQSRLHGNEFNTLSALNELYFYINKYKEEILTALDRDGYC
RKHKLRHKLEQAINLMAGSS
Download sequence
Identical sequences H2MW36
ENSORLP00000023051 8090.ENSORLP00000023051 ENSORLP00000023051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]