SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023327 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023327
Domain Number 1 Region: 410-473
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000899
Family BSTI 0.076
Further Details:      
 
Domain Number 2 Region: 61-118
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000245
Family ATI-like 0.045
Further Details:      
 
Domain Number 3 Region: 111-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000858
Family VWC domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000023327
Domain Number - Region: 506-565
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000777
Family BSTI 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023327   Gene: ENSORLG00000018665   Transcript: ENSORLT00000023328
Sequence length 702
Comment pep:novel scaffold:MEDAKA1:scaffold898:52390:68988:1 gene:ENSORLG00000018665 transcript:ENSORLT00000023328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSTFLSPATECLKEKWKPYEDICSKNNYKASKEVKCSFFNEIALQCKDKPYFTKSKLCEK
PTCPGELKFNETGSPFAPSCSNPNPSSSETVQTCVCRDGKVRNDRVNASQCVRRSDCPCV
FAGKIYQPGTSRNTRCQSCSCNGGNWVCSANICPPKCTVEGQFVETFDGKPYTLPKRCRY
VVSKGSNWTIKADFSASEIEVTKVVIELFEETYTFEDKKVKLKEKEITEFHKSDQALVFW
QSSMFVLVQTSFDMKIQVQMSPIMQLYITLPGNNIETLSGLCGNGNNDTTDDFTSSNNIR
ESSSGPFALSWAYGLTGGSQCTTEDIPTVCVNSAAEIFAADRCAALINNKVFAECHSYIS
PEAYRADCIKTTCTCGSNKEDCVCTALGNYAKACTGLGIKLGDWRSSTNCTISCQTNQVF
SYNNVICNSTCSSLSGNDPRCEVKDDPVEGCGCPEGTHLGDTNVCISKAECPCHYLGGTT
PPGQKVIDGLLCNCENGELECSKDCGCTKGKVCYHCSQGWMSTAQKTCESLLKAVDSSYT
CVSGCYCPLDLYEDHHENCVSRDKCTCRHEDKVFGAGEKLQTGQQTCVCIEGVWNCTDNP
QPGRCQVYGNGHFQTFDLKWYSFDGHCQYTLVEDKTFSIRVETVPCCEKELTCSRSVIMD
LKGGVTLTLRDMNITKEYKYGWSPDKNSLVTIHSVGMYFIIL
Download sequence
Identical sequences H2MWR9
ENSORLP00000023327 ENSORLP00000023327 8090.ENSORLP00000023327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]