SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023697 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023697
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily EF-hand 4.43e-31
Family Calmodulin-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023697   Gene: ENSORLG00000018989   Transcript: ENSORLT00000023698
Sequence length 187
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig49:713411:715793:1 gene:ENSORLG00000018989 transcript:ENSORLT00000023698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTTFTEEQLEAYQDCTYFTRKEILRLHGRFRELAPHLVPLDYTNNPDVKVPLTLIV
TMPELKENPFRERIVETFSEDGQGNLSFNDFVDMFSALCEASPRELKTIYAFKIYDFNRD
NFICKEDMDKTLNKLTKGELTAEEVALVCNKAIEEADLDGDSKLSFADFENMISKAPDFL
SLCQIPL
Download sequence
Identical sequences H2MXM5
ENSORLP00000023697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]