SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023715 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023715
Domain Number 1 Region: 682-920
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.76e-77
Family Eukaryotic proteases 0.0000544
Further Details:      
 
Domain Number 2 Region: 328-448
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.15e-34
Family Frizzled cysteine-rich domain 0.00028
Further Details:      
 
Domain Number 3 Region: 1-111
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-27
Family Frizzled cysteine-rich domain 0.00066
Further Details:      
 
Domain Number 4 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 5 Region: 453-487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 145-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 255-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 221-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 587-667
Classification Level Classification E-value
Superfamily SRCR-like 0.000000113
Family Hepsin, N-terminal domain 0.073
Further Details:      
 
Domain Number 10 Region: 497-530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 11 Region: 536-568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023715   Gene: ENSORLG00000019007   Transcript: ENSORLT00000023716
Sequence length 927
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig203:140452:157635:-1 gene:ENSORLG00000019007 transcript:ENSORLT00000023716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQLVLEPQCHMLPYNQTWLASSVAVVKSTEVDMLLRFFSYLGRLSCYRHIMLFGCSLALP
ECIPGGGAHSRQVVLPCASFCEAAREGCEPVLQMFNASWPDFLRCSQFSSMMSSLAPPSS
PSPPEAEGPGCFTPRQIKGRPSVCGGKEHFLCATGICVPQKLVCNGFNDCDDWSDETHCD
CADEEFRCNTGRCLPPPLRCDGYDDCGDLSDELNCVCNLSREHRCGDGRCVSRDWLCDGD
HDCLDKSDELNCSCKSQGLLECGNGQCIPSAFRCDGEDDCKDGSDEEHCSREQTPGGCGP
GQPVCSAPSCPSTCEGNGACDPRNGTCSRCEPISLELCMNLPYNLTSYPNLLGHLSQRES
SVSWESSLFPALVQTGCYQYLMFYACTLLVPKCDPVSLQRVPPCRSLCRDAKEKCESVLS
IVGLQWPEDSDCSQFPEDGGDAACLLPEDGVDECSPSHFKCRSGRCVLGIKRCDGHLDCD
DHSDERTVLSSCSERALWECPASKACIKPSMICDGFSDCPLMEDEANCRCCSERALWECP
ASKACIKPSMICDGFSDCPLMEDEANCISLSDQSGSVLTVFKTAAEYQVCADEWNHQLSS
LTCSQLGLGVPSSVSMVTDQPGVAGRRRWLHVHPEWNLRNGSALQARLEKRSHACHSRRR
VSVLCTREECGQRQVGGVTRHRRKRILGGRVSRQGAWPWQCSLQSGQSGHVCGCVLIARK
WVLTVAHCFEGRESADLWKVVLGLTNLDHPAAHSQSRGVRSIIVHPRYNRAVVDYDISVV
QLDSEVEETAFVRPVCLPRPGQLPSPDSYCYITGWGHMGNRMPFKLQEGEVRIISLPQCQ
SYFDMKTITARMLCAGYEAGTVDSCMGDSGGPLVCEEADGGRWTLFGLTSWGSVCFSKVL
GPGVYSNVTHFTPWIRQQIYIHTYLSD
Download sequence
Identical sequences H2MXP1
8090.ENSORLP00000023715 ENSORLP00000023715 ENSORLP00000023715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]