SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023843 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023843
Domain Number 1 Region: 58-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000131
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000023843
Domain Number - Region: 12-44
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00123
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023843   Gene: ENSORLG00000019125   Transcript: ENSORLT00000023844
Sequence length 164
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig88:718585:724429:1 gene:ENSORLG00000019125 transcript:ENSORLT00000023844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEAEKVVLEVITDSSPCSTTCGLGIRTQTLCLLDASQTKVSEECRVRKVNCLELWQCGLQ
TMTVTTGQRVEIDCLGEVMEAMGRFSWRVSWRYARGIITSDDSLFERWTAPLLDRMVLDP
VKEENAGTYRCDVQDTNFRRVKRIYWGIRVLPVGVVNLDYESAL
Download sequence
Identical sequences H2MXZ7
ENSORLP00000023843 8090.ENSORLP00000023843 ENSORLP00000023843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]