SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023864 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023864
Domain Number 1 Region: 18-213
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.62e-21
Family WD40-repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023864   Gene: ENSORLG00000019146   Transcript: ENSORLT00000023865
Sequence length 222
Comment pep:novel scaffold:MEDAKA1:scaffold2080:8390:10053:-1 gene:ENSORLG00000019146 transcript:ENSORLT00000023865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKKGVIGSVEDSRVQTMLSVAFGANNLTFSGAINGDVYVWREHFLVRVVAKAHSGPIFT
MYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQLETGQPVENVRSVCRGKGKIL
VGTKDGEIIEVGEKNAASNTMINGHTHGGIWGLASHPFKDVFISAGDDGTIRIWDLVDKK
LLNKVSLGHPAKCTSYSPNGEMVSIGMETGEFIVLLVNSLTI
Download sequence
Identical sequences H2MY13
ENSORLP00000023864 8090.ENSORLP00000023864 ENSORLP00000023864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]