SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024271 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024271
Domain Number 1 Region: 139-353
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-63
Family DBL homology domain (DH-domain) 0.0000000659
Further Details:      
 
Domain Number 2 Region: 338-493
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-45
Family Pleckstrin-homology domain (PH domain) 0.0000019
Further Details:      
 
Domain Number 3 Region: 37-164
Classification Level Classification E-value
Superfamily SH3-domain 1.27e-21
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024271   Gene: ENSORLG00000019497   Transcript: ENSORLT00000024272
Sequence length 555
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig236:1347542:1372115:1 gene:ENSORLG00000019497 transcript:ENSORLT00000024272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPDGASDKAGDELGSEDDLYEDFRGSGHRFGHPGGGGGEQLAINELISDGSVVFAEALWD
HVTMDVQELGFKAGDVIEVVDATDKEWWWGRIMDSEGWFPASFVRLRVNQDEPMEEYLAH
LGEIQALDEGQASLGSLSGPGLPCKEQMRTNVINEIMSTEQDYIKHLKDICEGYIKQCRK
RTDMFTEDQLRTIFGNIEDIYRFQRKFLKTLEKRFNKEQPHLSEIGCCFLEYQTDFQIYS
EYCNNHPNACVQLSKLMKVNKYVFFFEACRLLQRMIDISLDGFLLTPVQKICKYPLQLAE
LLKYTNPQHRDYKDVDAALNAMKNVARLINERKRRLENIEKIARWQSSIEDWEGEDVLSR
SSELIFSGELTKLSQPQNKSQQRMFFLFDHQMIYCKKDLLRRDMLYYKGRLEMDQMEVID
LEDGREKDFNISVKNALKLRSLNTEEIHILCTKKPEQKARWLRAFADERRQVLHDRETGF
SLTDLQKKQAMLNACKSHPAGKPKAVTRPYCDFLLRQKHPSLPTALPQQQVFMLAEPKRK
TTFWHNIGRLTPFKK
Download sequence
Identical sequences H2MYZ9
ENSORLP00000024271 8090.ENSORLP00000024271 ENSORLP00000024271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]