SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024476 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024476
Domain Number 1 Region: 144-406
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-32
Family FCH domain 0.035
Further Details:      
 
Domain Number 2 Region: 614-718
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-28
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 
Domain Number 3 Region: 556-607
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000718
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024476   Gene: ENSORLG00000019692   Transcript: ENSORLT00000024477
Sequence length 726
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig199:116903:124840:-1 gene:ENSORLG00000019692 transcript:ENSORLT00000024477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTESLVSENMKDLQELVQERLAELFRALKAVIGKHRTLNSVDVLGAAGTVMAKVKGVKFS
EVTFEDQSAVFREIHAAIDTLAFTFGNVVSDFLMGDVDRASGLGGPQTRRSRSFDDLSAD
PDRHHKRDGGEEEVDLTLLRNEVGVESALLYAKAWSKHIKDLLVWMEKRVSMDIEYAKNY
SKIAESAKALASQQDFMPFSDIYISTFKKDIEHNTLLLQTALALQSNKFIQPLLARKNEL
DKLRKELKEQWQREQRKMHEANAALRKAQTLAEQRQEEYKKVLSSSSRSQEEQGNPGNKQ
LDRRRRLEEEALQKAEEAQDQYQSCRADAGVRRMDLANAKRTVLTQLRETIFQCDLTLKA
VTVNWLQIQQAQTVVAPTHYQALNENAKLYEPGECYAEFVRNLPRNLPKEHLHSVSCEGS
RFGFNKRFLSSSHSSQGNLSQTSTTVCDEGDLLHPQPVKMGGERSSSSTDLPGASGSQVS
QGGVCSDSESAGGSSESRSIDSPTASPGDLRRRLPRTPSTGTMSSADDLDDREPLSPLDN
GESSPGPFRNAQMSKAAQTHRLRKLRAPSKCRECDGLVVFHGAECEECSLACHKKCLETL
AIQCGHRKLPGKLQLFGVDFALAAKNCPDGIPFIIRKCASEIESRALNVKGIYRVNGAKS
RVEKLCQAFENGKDLVELSEHSPHDISNVLKLYLRQLPEPLILHRFYNDFIGLAKESQRA
SKEGGG
Download sequence
Identical sequences H2MZH2
ENSORLP00000024476 ENSORLP00000024476 8090.ENSORLP00000024476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]