SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024516 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024516
Domain Number 1 Region: 193-235
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024516   Gene: ENSORLG00000019727   Transcript: ENSORLT00000024517
Sequence length 431
Comment pep:known_by_projection scaffold:MEDAKA1:scaffold387:212588:236380:-1 gene:ENSORLG00000019727 transcript:ENSORLT00000024517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPAGADRAHPQVTSQENPGVESLGLEELQQENLLQILASSPTPLLRWSKHSGVLSAPAP
EDHPESFFLDLKNLPVLGHADTGSQNPNIQVTIEVVEDTPTETEVEMDLAKEGQRNNWSA
EWININKKLFWPLFWEYPDQAENELGGASSQEEPEEYSYNPEDSVLSQVGGGWAQYWNKG
WDPKDKYASRNTEYEDWSGWAPCSATCGFGTQKRSRSCGYACTATESRTCDLESCPGKRH
TLFEPFPSGRRNRAIRTRTSVDSCEKWLSCRNDFLQRYLHQVRTQLPSCPCSYPSEAVYS
AVNIPDDHLQRTYRWRDASGPKERLDIYKPSARFCLRSMLSYDSTTLAAQHCCYDDRMRL
ITRGKGAGSPDLISTEFSPELHYKVDVLPWILCKGDWSRFHSVRPPNNGLDCEENPPEPV
FQTELREAGEF
Download sequence
Identical sequences H2MZK8
ENSORLP00000024516 ENSORLP00000024516 8090.ENSORLP00000024516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]