SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024647 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024647
Domain Number 1 Region: 107-202
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-30
Family Kringle modules 0.00032
Further Details:      
 
Domain Number 2 Region: 41-96
Classification Level Classification E-value
Superfamily GLA-domain 7.06e-22
Family GLA-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024647   Gene: ENSORLG00000019844   Transcript: ENSORLT00000024648
Sequence length 225
Comment pep:known_by_projection scaffold:MEDAKA1:scaffold1449:20315:30193:1 gene:ENSORLG00000019844 transcript:ENSORLT00000024648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPTLRTSAVVLLLILHNCAANHVFLKGQQASQVLVRNPRANQMFEELKPGNLERECFE
EICDHEEAREVFEQTDKTEIFWAKYLDCEGTVKHRTTKTIGLIRDCVEGHCVSGNGHNYN
GNIHITKSGRVCQHWSHSFPHPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSV
QKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTL
Download sequence
Identical sequences H2MZX1
ENSORLP00000024647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]