SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024892 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024892
Domain Number 1 Region: 109-382
Classification Level Classification E-value
Superfamily EndoU-like 6.02e-88
Family Eukaryotic EndoU ribonuclease 0.0000157
Further Details:      
 
Domain Number 2 Region: 64-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000209
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 22-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000445
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024892   Gene: ENSORLG00000020058   Transcript: ENSORLT00000024893
Sequence length 384
Comment pep:known_by_projection scaffold:MEDAKA1:scaffold1179:130:5964:-1 gene:ENSORLG00000020058 transcript:ENSORLT00000024893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTAVLLLCGTLFCRANSNRLDSCQGRCGASLDNTYSCQCNAHCENFNDCCSDYYTLCK
DAATSCSGRCGEQYNSQNPCHCNSLCSQYNNCCSDYSQFCDSSAGKGSATDAEIKAVSET
LYTLDSNKASASQLKIDPQALVADSQTSSQTDLSSSRLYSYLDEGTLFSKPTYAAFLALL
DNYNWMTGTTESFTSQQLAEQDTFLKETMSNTEVGKELFAFLYTKGYYASEAEFIQDLKN
MWFGLYSRYNGKMDSSGFEHIFSGEIKGGKVSGFHNWIQFYLLEKKGELNYYSHSFDGPW
TSYPDVLGMQFMWKGYYKQVGSAIIGCSPEFDFALYSLCYITRPGKQCRLSLGGKDLIIQ
TYTWENSFYGDGKKFIGSAYPASP
Download sequence
Identical sequences H2N0I2
ENSORLP00000024892 8090.ENSORLP00000024892 ENSORLP00000024892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]