SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024944 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024944
Domain Number 1 Region: 33-482
Classification Level Classification E-value
Superfamily Sema domain 5.89e-109
Family Sema domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1566-1694,1876-2063
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-38
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 1135-1227
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000116
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 1042-1138
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 5 Region: 485-537
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000209
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1226-1347
Classification Level Classification E-value
Superfamily E set domains 0.0000000000669
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024944   Gene: ENSORLG00000020098   Transcript: ENSORLT00000024945
Sequence length 2096
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig90:2186100:2229238:-1 gene:ENSORLG00000020098 transcript:ENSORLT00000024945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSSHLYTLHVILALLCPSQVEASVQRVKLESAPLSHLLLDEQTGQLYVGGVNNLYQL
NSNLEVLAHVKTGPNLDSPDCLPPISQQDCPSATVTPNHNKLLLLEDGVGEEPGNLIVCG
SLFQGICNKRSLSNISHIIYQTSNPVDTQYVAANDPRVSTVGVIITAKGKQEEEGASGTL
HLLLVGRGYTSRGPGDIPPITTRRLFPANSLRRAFSQEEELGKLVVGSYSEYNNHFVKAF
IYGNHAYFLFSRRDMWHRKEYRTYVSRLCISDRSFYSYVEVPLLCRGGYNLAQGAWLWKY
SGKATLFVVMATGQASTPVATSHSALCVYGMDALDALMQQAQEVCYTEAGQGRSGGEEAY
IEYAVSSKCLRLPKDSLSEYPCGGEHTPSPIASAVALPATPTVTMLTLLTAVAVATEAGH
TIAFLGDVKGQLHKVFVRPDWSGDLYGSLAVDSGAVGADLLLDVSQQYLYVLTNDKLSKV
PVSSCERQTDCSSCLSVRDPYCGWCVLEGRCVHKHECQRHLQANHWLWSFESTNQCVTVQ
NLQPANQSRAEQTQVTLSVAQLPALEKTEFLSCIFGQLSPQPAVIVGTKVTCQSPEPELL
PTTPTGKDHMILPVSLTLGHVTITTGNMTFYDCGSVSRLNQSSQCVACVSCVWGCNWCPI
EQLCTHNHSCPTPNIILSQRSDSLSPPPSHRDCPFPLSCGHPEKKILGSSGPSSCPLVFS
LRSSALVPMGQSTTIVLEWLPWMGRNNGSTTSSSWVTEFFIPSDEHSNSITYGTYLPFSS
FTPSFTCEQDTVKPTKEREVMDSNPCCGLGPDASLHSIVGLDWLARAPVTCVCVCVGGGE
GSKMQRRGGRWLQTQSTAEQKPTLEVNGPKSVLILSVYLSSIKTTETQYSLEWVIGGSPK
SPTGCLFRSHSGLVERLAEFHSDSNNEGDYECVIEIENVQLNLTATEEKTAENTHILTCK
SQKFHYSTSRLQYSAPVYLRRGNRRIDTLPELQVHLYDCSAGQSDCSQCWAVPREYGCVW
CPGRPAPICVYNQSCFSEPADTCPPPQITQVVPVTGPLEGGVLLTITGSNLGMRYQDVVG
RVHVAGVPCVPQMEGYQISTRVVCELQPSGKQRVGPVSFSMGTSLPGGSTQIFTYQDPHL
LDLVPDKGPVSGGTRVSIRGRHLLTGQMSDLSVFLGPWPCRILGEVNDTRLVCQTGSSNQ
TGEVPVWVLFGKAKRTVPKRAFRYLDDPMITDAMPAESFCAGGRIIVVTGRNLDVVQQPI
MSVWVEPQEVQRVKRKRIPPVLTCLPLTCLSVCQVSERCSVLSSSQMTCPTPAVFPDLKV
KGVWFQLDNVQVHFESIKGKSFTYYPNPKLFPLNSEAADVPYHFKPGGVIAVEGRDLTRA
MGRREVIARLGDQKCEVKTLDSTHLYCEPPEVQPMSVDDGHQLPRLKVFMGNLKVDLGLV
QYDSDSMLSPVPLAAQIGLGAGAAAIILMVLVVILMYRRKSKQALRDYKKVLLQLETMEI
NVGDQCRKEFTDLMTEMMDLSSDVGGPGLPLLDYRVYAERVFFPGQQMALLSRQLDLPES
RRLTVEQGLQQLINLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTIALHDKLEYFTE
VMKSLLQDLVQQYVTKNPKLMLRRYEKHAQSTLTNWSSLCLYSFLKEVAGEPLYMLYRAI
KYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCAMTLTVLVKNGVEVQPCPVKVLDVDTI
TQVKDKILDQVYRGAPFSQRPAADSLDLEWRSGQAGHLTLSDDDVTAIVQGHWKRLNTLQ
HYKVPDGATVALIPRSQSSGGISQVFQTGEKTPMLEGEEEEGFRLWHLVKSSEDPEIPKH
RKSSMRERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILNTKRPPPIAVRFFFDFLDD
MAEKHGIDDPDTVHIWKTNSLPLRFWVNILKNPQFVLDVQITDSIDAILSVIAQTFIDSC
TTSEHKVGRDSPVNKLLYAREIPRYKQLVESRYYSDIRSAASGCYQEMNSYLTELSGSFA
SEMNSVVALHELYKYISKYYDQVIMSLEEDASGQKMQLAYRLQQVAALVENKVTDL
Download sequence
Identical sequences H2N0M9
ENSORLP00000024944 8090.ENSORLP00000024944 ENSORLP00000024944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]