SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024945 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024945
Domain Number 1 Region: 997-1285
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.07e-70
Family Complement components 0.00000311
Further Details:      
 
Domain Number 2 Region: 1363-1510
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.22e-30
Family Alpha-macroglobulin receptor domain 0.001
Further Details:      
 
Domain Number 3 Region: 1540-1662
Classification Level Classification E-value
Superfamily TIMP-like 2.12e-27
Family Netrin-like domain (NTR/C345C module) 0.0014
Further Details:      
 
Domain Number 4 Region: 671-733
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.00000000000000575
Family Anaphylotoxins (complement system) 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000024945
Domain Number - Region: 827-910
Classification Level Classification E-value
Superfamily E set domains 0.0091
Family Arrestin/Vps26-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024945   Gene: ENSORLG00000020102   Transcript: ENSORLT00000024946
Sequence length 1664
Comment pep:known_by_projection scaffold:MEDAKA1:scaffold294:649625:688272:1 gene:ENSORLG00000020102 transcript:ENSORLT00000024946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRHTPRCFFISFRLVSTAQTLQTTPRFTIITPDLLRTDSQENIYLEAEGLSNPVFVSIEI
KDFNKISMLFIDNATLNQDNGFQVLKSIQLSSNFLNREEKKNKFVYLTVSFQGYHTEERV
LMVSFHSGYIFIQTDKPIYKPGDNVRFRTFMSSPFFKAFDSSITIDITNSDGVVVKQITR
TRAVKGVIADTFPLSEIANEGTWQVTAKFDHWQQNTFTSPFQVKKYVLPAFNVTLTPTKS
FISLDDSELVVEITARYLFGEPVEGTAYVVFGVKMNQEMKRLPSVKQLSDECVQLDGGRV
SLSIEELKAAYPDPETLVGHSVYVKASVLTKTGSDLVEAEKTGVKIVKSPYVISFTDSPK
YFKPGLPLDLTIEVSNHDGSPARNVQVKISQLDVPVIASAGTARASINMPDDQQPQTITV
ETIQADLRPDQQARTQITLQPYVAFNQHQQNYLYISTGSKSVSVGDRVSLDISVKMSIQE
NRKLVKHITYLVLSNGKILKAERADVTDRSVTNVGLVVTSEMMPSFRVVAFFSLPWVGRE
EVVSDSVWIDVVDACIGGLTVGSGDSTPRTLAPGQSVRFKIRGDPGSKVNLVAVDNSVYL
LNKDRLTQKKIWDVVEHGDMGCTRGGGRDASGVFVDAGLLFSSSAGFKTQTRQVLHCPGR
ARRRRSAEQLKRKQRLENHYKEKLERRCCKDGLREIPMPYSCTRRSLYITEGWECMRAFR
YCCSTYRGQAMDRRPEEAVVMPMLEAAEEEEDEEWEEVDESQIYLRHKFFESWLWMDIDL
PSKAERDGLASLNLDSALPDSITEWGVLAISASPHTGFCVAQPYNIQSWKHFFVDLRLPY
SVARFEQLEIKAVVHNYGYDALQARVVLMKTEKICSVAFKDKHTQEVTVPASSSVAVHYT
IVPLEVGNLPLEVTAFAKGMVGSDRTQKSLRVVLEGVEKTKVQTVVLNPSAHGEVYEEDK
PVSIRPCCSQMPSLPLIPPLFLSLGNVLADSIDNSISEDSLGALIQMPGGCVEQNLATIT
LPLIATLYLDRTGSWESVGVQRKAEALGYIKRGYENQLEYRKTDGSYPPYSRQEASTWIT
AYVVKVFSMAYSVVSINKNQICDPLIYLVNNKLRQRVGMYKEDNPVYSTTMTGGLRGGDP
EITLTAFVHIALSEAKRAGILCTSSGTANEWTTRYLKKALLTKGRRPYTVAIASYALALH
EAPPNLHEALLQAAAPDSSHWPDRENFLFQLEATGYALLTLVKLGRMEDAAAPFKWLNNQ
RRRGGGFGSTQSTMVVLQALSEYMINKPREDTNLDVDIKIAGRRDLRYHFNPDTAYAARS
SKVKQLSHEFDVVVKGSGEGILEVVTYYNQLLEVDEKKPCNDFELSVNVEESTDIYVIKT
YKISIKVRALGPRDVRMVVLDISLPTGFTPENSDLEMLSNSVDRYINNFQIVDNLSERGS
LIIHLFKVSHKEPEIMIFRLQQNFKVGLLQPSSVTVYEYYNPDHRCSRTYTPREDREELT
QICKDNVCRCAQSNIDLKKAAYITKHSNKYKICNNTDHTKGERFFQVKVLSISQDYYDKY
EMEIMQVIKLGVEDRVEVGQRRLFMSHGGCREDLQLKEGSQYLLMGPKEDQWRIDPDTNR
FIYTLGKNTWMERWPSPAECSSMEDKCRSLSAAVNDLSESGCRM
Download sequence
Identical sequences H2N0N0
ENSORLP00000024945 ENSORLP00000024945 8090.ENSORLP00000024945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]