SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025391 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025391
Domain Number 1 Region: 107-154
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000366
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 275-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 1188-1245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 538-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000562
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 935-985
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000549
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 6 Region: 675-728
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000981
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 1070-1119
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 600-670
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 9 Region: 1313-1377
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000419
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 1244-1294
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000889
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 11 Region: 337-419
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 12 Region: 859-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000916
Family TSP-1 type 1 repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000025391
Domain Number - Region: 30-102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00119
Family TSP-1 type 1 repeat 0.012
Further Details:      
 
Domain Number - Region: 996-1065
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00222
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number - Region: 1123-1171
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00262
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number - Region: 420-482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0129
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025391   Gene: ENSORLG00000020495   Transcript: ENSORLT00000025392
Sequence length 1554
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig257:472085:589772:-1 gene:ENSORLG00000020495 transcript:ENSORLT00000025392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWSSHHSHCRHSPKPESQRQCYKVCDWHQDLFEWDVSDWGPCLLIPFLSNELRLRTADCI
TAQHGIQRRSIHCVRTSNRTAVSSRICEFFSHKPPVEQACLIPCPQDCVVSDFTPWSSCS
KTCGVGLQHRTRHVLAPPMYGGADFPNLTETRTCTNSVDCSIGEGEYQYSLKVGAWSECR
LPQHKDAVLNGRTILDYSANSNENNTVTLHTVAFHHHSHHHNYTHIKNPVSWELEVGYQT
RHVRCTRSDGKNSMLSLCTKDSSPLTFQACVMPEDCQTSDWSPWSPCSKTCRSTDLSPGF
RVRSRIMTQIPHGGGKACPPLQEKEACNIIGDLLPTCPRYVWRSTDWNECHILPLLGQQD
QRQVNVSSLCGAGIQTRKTYCVQVPEDSAPHHRKEVSRPVDGRLCDGNEPPLAVQSCSVP
CQHHCVLSQWSSWGPCIHENCKEPQGKKGTRRRTREVLWQSGDALGSCPHVVEFTPCEDP
VCYLWQVQREDRCVPTRGSCGPGAAVQNVSCVDVEGEHVPDTHCEGGAPPAEDACEVPCP
ADCVVGSWSLWSPCSHSCANKTAEGRQSRTRTVLAIPRKDGKSCPAAPALEEWRVCSDHP
CMVFHWEASAWSPCVQNSSARLNLSALGNDACAVGVQSRRVTCVKKSGGPVSSKRCSDSS
RPESSRPCLLPCKKDCIVTPFSEWTSCPSTCLPENGTAVTQSRYRTIIQRPANGGQECPD
TLYEERDCDFLPGCPLFRWRMHKWHSCILVPDSVRRGLSGAGEDCGDGLETRGVSCVGEN
GEAANLTACLRWAGSLPPQIRTCRVACKDDCTLTAWSKFSECAGCGSTRSRTRSLTGRSK
KRERCLNEELFPLEEVEACPCDQFLSQPYGDWSACILPDRPLHRPPHGWMSRREVKECGQ
GLRFRAVACVNQQGHLVKPTLCTQAGYIMEVCHIPCPLDCKLSDWSAWSACSASHGSGLK
IRSKWLREKAFNGGRPCPKLDLKNQAQVYEAVPCRGGSSQNEWRSEAWSICTINTVDDLP
ACGEGVQSRKIRCVKKGLMSGEESIVDDSQCDAEEMPPRAQVCHLACPDDCVVGPWGPWS
SCPLHCDAESVRNRSRKILRESALESGTCPEQIQSESCVLNGTCFTYWFRASEWSTCQLS
EGAVCGPGFRLRLLDCVRSDGKIVAMQMCEQFGVTSTWPLLEDCVVECSVSCLLSDWSPW
SECSHICGSQGQLVRNRRILQESHQEGRLCPSQLNQTKSCPVKPCYDWLLSDWSACIVEG
AECGEGVRRRNLSCIVHWGNLNEPPPQPVETELCGDAMRQQLLQQMEQPCFVPCPGDCHL
TEWSPWSSCQLICLEGRSFEYTGRQARSRAVIIQAMENQASCPHQVFETKSCKEGKCHTY
QWKTGGWSNNERAVWCQRSDGVNVTGGCFQQKRPTTLRHCHPPCTKPFSHCTPSGVCGCE
RGYTEVMTSHGFLDYCTRTPGFDNNKKADVKTTSGRLKPRPSQANDLFSEWTLRPVGPDG
RVKLWVYAVAIVGFIIILFVVVLSFLICKPSKTSATSSPPQKPLTLAYDGDMDM
Download sequence
Identical sequences H2N1S8
ENSORLP00000025391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]