SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025439 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025439
Domain Number 1 Region: 369-458
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-38
Family Kringle modules 0.0000432
Further Details:      
 
Domain Number 2 Region: 184-270
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-35
Family Kringle modules 0.0000919
Further Details:      
 
Domain Number 3 Region: 273-358
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-34
Family Kringle modules 0.0000773
Further Details:      
 
Domain Number 4 Region: 91-184
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-34
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 5 Region: 464-548
Classification Level Classification E-value
Superfamily Kringle-like 1.75e-30
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 6 Region: 21-101
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.71e-18
Family Hairpin loop containing domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025439   Gene: ENSORLG00000020532   Transcript: ENSORLT00000025440
Sequence length 548
Comment pep:known scaffold:MEDAKA1:scaffold1775:14710:21947:1 gene:ENSORLG00000020532 transcript:ENSORLT00000025440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFCWKAALLLGAVICSASSSDVEGYSKTEGAWVLSLHRRQYSVNSVTDCAAKCNAETTF
TCKSFAYVEKDQECWTAASNSKTEPVLRRQNSALYEKNDYLLECVNGLGTDYRGTKAKTK
SGKVCQRWEARFPHRPNITPQTHPRADLDSNFCRNPDGDSRGPWCYTTDPETRWEHCNVT
SCGEDCIHCNGEDYRGKASITENGYTCQRWDSQSPHSHGYNPDAIPEKYLEENYCRNPDG
DPRPWCFTTSSSKRWDYCAIPRCTSEPPTIVPELTCASGEGQAYRGTVGVTVTGKACQMW
SDQTPHKHSRTPENYPCKGLDNNYCRNPDHEKMPWCYTTDPETRWEFCRVPRCGDSPDPD
EAVSPPEENNDCYEGNGANYRGVTSETVSGKKCQMWSSMSPHSHDKSPQNFPEAGLRRNF
CRNPDGDRAPWCYTTDPKVRWEYCSLKKCSEPTKSPQPQDTQSPAEKDCKIGNGESYRGP
TSITVSGVTCQGWRDQSPHTHSSFTPQTHPDKGLEGNECRNPDGDSNGPWCYTTDRNKKW
DYCQIPDC
Download sequence
Identical sequences H2N1X4
ENSORLP00000025439 ENSORLP00000025439 8090.ENSORLP00000025439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]