SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025645 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025645
Domain Number 1 Region: 15-144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000213
Family Growth factor receptor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025645   Gene: ENSORLG00000020705   Transcript: ENSORLT00000025646
Sequence length 245
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig182:900038:980637:1 gene:ENSORLG00000020705 transcript:ENSORLT00000025646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIVLNCMEYSNCQAPSHRWRRNKRASYGTHSICKGCLTCSPVNGCVKCPPK
LFLFLRRERMRQYGECLHDCPAGYYGMRGPEFNMCSRCRIDNCESCFSKDFCTKCKSGFY
LHKGRCFDKCPEGFAPLEDNMECGEGCEVGQWSDWGACTRRNKTCGYKWGLETRTRHIVK
KPPKDTIPCPTIAESRMCKMAMRHCRRGGSGKHRSKEPKKKNKQRLRFRAQNQHSDHLAS
ARSSQ
Download sequence
Identical sequences G0ZE07
NP_001239174.1.28442 ENSORLP00000025645 ENSORLP00000025645 8090.ENSORLP00000025645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]