SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000215 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000215
Domain Number 1 Region: 318-435
Classification Level Classification E-value
Superfamily TIMP-like 8.16e-17
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 2-48
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000215   Gene: ENSORLG00000000178   Transcript: ENSORLT00000000215
Sequence length 443
Comment pep:known_by_projection chromosome:MEDAKA1:3:2824104:2850069:1 gene:ENSORLG00000000178 transcript:ENSORLT00000000215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWLPWSGWSVCSRTCGGGASVRTRTCITRNLVGRPCAGEPRQYKICNTKECPPGSQDFRE
MQCAVFNQRPLVAGNSFKWTTFHGGSNPCELSCMALGHNFYYNFGHVLDGTPCSDEGGVM
CVSGRCLKPGCDSILGSGQEDDACMVCGGHNSTCLQHRSIYKSNRLEAGGPFGYNQVAMI
PAGATHIRVTDNSRDYLALQNKHSQFVINGNWKISVPGEYSIAGTKLLYKRSADTWESFE
VPGPTQEDLHLMVLAMDRNSGIEYEYWLPPDLYALFHGGKSSLRQALHTTSFFQRSPSST
TPSASATSRPLLSTGRPHPRRCGKCLRVRGRRERRRQYCQKDFVFRGKVLEKVQSGKETR
YDVQIIHTYRNRFRLEHREFLWVPNVCDCPHLEGGRQYVFMARRHINYERTLNRILLEED
SYVVPYRPREDELLWTLEGLCSS
Download sequence
Identical sequences H2L3A3
ENSORLP00000000215 ENSORLP00000000215 8090.ENSORLP00000000215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]