SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000309 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000309
Domain Number 1 Region: 20-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.71e-89
Family Eukaryotic proteases 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000309   Gene: ENSORLG00000000252   Transcript: ENSORLT00000000309
Sequence length 316
Comment pep:known_by_projection chromosome:MEDAKA1:8:571401:574292:1 gene:ENSORLG00000000252 transcript:ENSORLT00000000309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLQNFLDLNESLRLSVLSTGAEAQTDVCGKPPLNTKVGTRIVGGQAAAAGAWPWQVRLD
INGALCGGSLINNQWILSAAHCFSSTSTAGVVVYLGETEINNSPNSVSRTVSRIIVHPNY
NSDTHNNDVALLKMASSVTFTDYISPVCLAAQGSDFPGGTTAWVTGFGTLSSGGSAPSTL
QEVSVPVVNNTQCNSSYSIITSNMICAGLTEGGKDSCQGDSGGPLVTKNGTTWIQAGVVS
FGNKCALPNFPGVYARVSEYQTWISSLVSSSSISAAHFISMTEETTHRGGSPSLVHCHQC
VTKNMPGRIIVVFIRF
Download sequence
Identical sequences H2L3I6
ENSORLP00000000309 8090.ENSORLP00000000309 ENSORLP00000000309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]