SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000525 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000525
Domain Number 1 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 44-100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 99-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 5-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 253-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 283-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000448
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000525   Gene: ENSORLG00000000426   Transcript: ENSORLT00000000525
Sequence length 342
Comment pep:novel chromosome:MEDAKA1:2:15304754:15307169:1 gene:ENSORLG00000000426 transcript:ENSORLT00000000525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESDKRPYVCEECGKGFTCISNLKRHMTTHTGEKPFPCDVCGIGFSQISSLNAHKRTHTGE
RPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGDKPFS
CKVCGTGFSQMSSLNAHIRTHTGERPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVC
DTSFSCVSNLKTHMRTHTGDKPFSCKVCGTGFSQMSSLNAHIRTHTGERPFSCKICDTSF
SQKSILDSHMRTHTGDRPFSCKVCKKSFSQKSSLNAHRRTHTGERPFTCKGCDTNFSQKS
NLNKNKNHTSQKPFYCQKCNKGPSRKCAHKTTHNNPKAGMCN
Download sequence
Identical sequences H2L443
ENSORLP00000000525 8090.ENSORLP00000000525 ENSORLP00000000525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]