SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001393 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001393
Domain Number 1 Region: 1-462
Classification Level Classification E-value
Superfamily Sema domain 3.66e-128
Family Sema domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 1314-1443,1658-1840
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 1007-1110
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000355
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.086
Further Details:      
 
Domain Number 4 Region: 821-919
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000036
Family Other IPT/TIG domains 0.0091
Further Details:      
 
Domain Number 5 Region: 920-1009
Classification Level Classification E-value
Superfamily E set domains 0.000000000000084
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 6 Region: 465-516
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000017
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1107-1197
Classification Level Classification E-value
Superfamily E set domains 0.0000021
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 8 Region: 764-800
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000068
Family Plexin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001393   Gene: ENSORLG00000001129   Transcript: ENSORLT00000001394
Sequence length 1877
Comment pep:known_by_projection chromosome:MEDAKA1:7:1999714:2227781:1 gene:ENSORLG00000001129 transcript:ENSORLT00000001394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHLVVHNRTGEVYLGAVNWIYKLSSNLTKLRSHVTGPVTDNPRCYPPPGVQSCPHELVQ
TSNVNKLLLLDAAHNRLIACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAEAGTMS
GVVISPDIFSGDGKLFVGTPIDGKSEYFPTLSSRKLMSNEENADMFSFVYQDEFVSSQLK
IPSDTLSKFPAFDIYYIYGFNSEQFVYYLTLQLDTQLTSPDASSEQFFSSKIVRLCVDDP
KFYSYVEFPIGCTKNGVEYRLVQDAYLARPGARLARSLGIREHEEVLFTVFAQGQKNRAK
PPKETALCLFTMRQIKEKIKERIQSCYRGEGKLSLPWLLNKELACINSPLQIDDDFCGQD
FNQPLGGTSAIEGIPLYVDKDDGMTSIAAYDYRGNTVAFTGTRSGRVKKITADYSASVSH
PALLYENVVVSDGNPILRDLLFSPDHQFLYALTDKQVTRVSVESCEQYTSCGECLGSGDP
HCGWCVLHNVCSRRDRCERADEPQRFTSRVEQCVHLSVHPETISVTMSEVQLVLQAQNVP
SLSAGVNCSFEDYVETEGRIYSGRIFCLSPSTKDVAPITRDQGDQRVIRLYLKSKETGKK
FASVLFVFYNCSVHQSCLSCVNANFPCHWCKYRHMCTQDASDCSFQEGRVNTSQECPQIL
PSTQIYIPAGVMRPITLLAQNLPQPQSGQRNYECIFHIQGSVHSVPALRFNSSSIQCQKT
TYDYEGSDISDLPVDLSVVWNGNFVIDNPFNIQAHLYKCRALRDSCGMCLKADPRFECGW
CIQDKKCSLRQECTSGGNSHQPLQLAEGAGWMHATSGNSRCTHPKITKLFPETGPRQGGT
RLTILGENLGLEFRDIQMGVRVGKVPCVPIEDEYVSAERIVCLLNDATSYRVQEAQVEVC
VRDCVNDYRALSPRPFTFVVQTPFFTRIQPSQGPVSGGTRVTIEGSYLNAGSYVSVSIGL
QSCHFKRRNAREMVCVSPAGMAAGAASVLVDIDDAELRNPEVKFIYTEDPTILRIEPDWS
IASGGTLLTVSGTNLATIREPKIRAKYGQAESFHNCTVFNNSVMVCLAPSVADSELGFSE
TGTGPDEIGFYMDNVNALVVVNETFNYYPDPVFEPLSPSGILELKPPSPLILKGRNLIPA
APGNNRLNYTVLIGETPCILTLSESQLLCEWPNLTGQHKVTIRAGGFEYSPGTLQIYSDS
LLTLPAIIGIGGGGGLLLLVIIAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEA
FAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKALTLFG
QLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRN
LESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDA
ITGEARYSLSEDKLIRQQIDYKTLDQTLKLILFDVSILCRFLCQTLHCVNPENENAPEVT
VKCLNCDTITQVKEKLLDAVYKGSPYSQRPKASDMDLEWRQGRMARIILQDEDVTTKIDN
DWKRLNTLAHYQVTDSSVIALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSR
TPMITPDLESGTKLWHLVKNHDHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFE
TIFSTAHRGSALPLAIKYMFDFLDEQADKHSITDYDVRHTWKSNCLPLRFWVNVIKNPQF
VFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKNWVERYYSD
ISRMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYTYIIKYKDEILSALQKDEQSRRQ
RLRGKLEQVIDTMALAS
Download sequence
Identical sequences H2L6E6
ENSORLP00000001393 8090.ENSORLP00000001393 ENSORLP00000001393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]