SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001452 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001452
Domain Number 1 Region: 154-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.28e-85
Family Eukaryotic proteases 0.0000641
Further Details:      
 
Domain Number 2 Region: 39-99
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-21
Family GLA-domain 0.00028
Further Details:      
 
Domain Number 3 Region: 88-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001452
Domain Number - Region: 127-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000204
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001452   Gene: ENSORLG00000001180   Transcript: ENSORLT00000001453
Sequence length 430
Comment pep:known_by_projection chromosome:MEDAKA1:2:16845697:16852874:1 gene:ENSORLG00000001180 transcript:ENSORLT00000001453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLRFLFILVFCFHSCWPASVFLDTRQANGVLQRSRRYNSGWFEELQKGDLQRECIEEKC
SFEEAREVFEHVELTNEFWKVYSIPESCKPRPCQNGGTCIPDGSSYTCLCLPQFRGVNCD
QEHKTKSDSCLVQNGACEHFCNEDAFGRRLNCSCADGYSLGDDGQSCVAKEPIACGMVPV
LQGHKQEEHLRIVGGTECPKGECPWQVLLVYKGKGFCGGVIYKPTWILTASHCLEDTDKQ
FLKIIAGEHNLAVNESTEQIIQVAEILMHPNYAKTTVDNDIALLRLASPITYTPYALPVC
LPTRVLAERDLWSVSMHTVSGWGRRSEHGPTSNVLRRTKIPRLRTQTCIEESGVALTKNM
FCAGYLDGRTDSCKGDSGGPLVTEYRKTVFLLGIVSWGKGCARPGNYGIYTRVSNYLEWI
HNRTATSNQP
Download sequence
Identical sequences H2L6K2
8090.ENSORLP00000001452 ENSORLP00000001452 ENSORLP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]