SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001488 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001488
Domain Number 1 Region: 12-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-92
Family Eukaryotic proteases 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001488   Gene: ENSORLG00000001209   Transcript: ENSORLT00000001489
Sequence length 258
Comment pep:novel chromosome:MEDAKA1:8:2423430:2426327:1 gene:ENSORLG00000001209 transcript:ENSORLT00000001489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQKISCGVNTGMNCGQPALNTRIVGGQDAPAGFWPWQVSLQKSSHFCGGSLINNQWVLT
AAHCFPSTNPSGVTVRLGLQSLQGSNPNAVSRSIVKIIIHPGYSSSTLENDITLLMLASP
VNFNDHIAPVCLAAASSSFYSGTDSWVTGWGNIGSGVSLPAPQNLQEVQVPIVGNRQCKC
SYGANSITDNMVCAGLLEGGKDSCQGDSGGPLVIKQSNRWIQAGVVSFGNGCAQPDFPGV
YTRVSQYQTWINTQITTN
Download sequence
Identical sequences H2L6N7
ENSORLP00000001488 8090.ENSORLP00000001488 ENSORLP00000001488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]