SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001597 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001597
Domain Number 1 Region: 6-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-93
Family Eukaryotic proteases 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001597   Gene: ENSORLG00000001302   Transcript: ENSORLT00000001598
Sequence length 282
Comment pep:novel chromosome:MEDAKA1:8:2526850:2528646:-1 gene:ENSORLG00000001302 transcript:ENSORLT00000001598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKSDCLILFSFFLIFIPESVAQLSDCGQANLNTRIVGGQDAPAGFWPWQVSLQTSAHFC
GGSLINNQWVLTAAHCFKSGSASGVNVVLGLQSLQGSNPNRVSRTVTTLIVHPNYNSVTA
DNDIALLQLSSQVTFNNYITPVCLPSTNSTFYSGVNTWVTGWGNIGTGVSLPAPQTLQEV
QVPIVGNRQCKCSYSSITDNMVCAGLLAGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGN
GCALPHFPGVYTRVSQYQTWINTQITTNQPGFITFTSTGTDS
Download sequence
Identical sequences H2L6Y9
ENSORLP00000001597 ENSORLP00000001597 8090.ENSORLP00000001597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]