SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002018 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002018
Domain Number 1 Region: 457-522
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000275
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 186-297
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000301
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 3 Region: 5-77
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000785
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002018   Gene: ENSORLG00000001623   Transcript: ENSORLT00000002019
Sequence length 528
Comment pep:known_by_projection chromosome:MEDAKA1:10:6446348:6451877:1 gene:ENSORLG00000001623 transcript:ENSORLT00000002019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKASFPGNLHLVLVLRPTSFFHRTVTDIGFRFSQDDFMLKMPVVMLSSVTDLLRYIDENQ
LTSEFGGTLDYCHSDWILLRTAIESFAVTVKDIAQMLQSFGTELAETELPDEGKIIENLL
ETHTEKYRELKDAIRSVSKEGRNLLSSLETTGKQDDAQWDIKLDWETVERLLAQLRDMES
AFDGFFEKHHLKLHQYLQLLRYEQSFSEMDLCLEHLMNQEKEFSTKVSTLAQTEQALKRM
DSLESNAQEVMSRAQILILHGHQLSAGHHYAMALIMQRCNELRHRCDTLSTALQSKHSIF
LQTHQLLLCLGQVQTWCDEGAYMLANQLVDKSQSKEGAQAALRDIERFLEGAPPNLNSGP
DILTIEYEAVLTPQLQAQISRTFEKHAAVQQMIQNRQACLRKLADKHVRPIQLVAPRPEN
PPRSKSPLFSPKHEVIHDFQESRSCVAYSVDGDDSPDLLKRHVMRELIETERIYVEELLA
VLLGYRAEMDNPMLSGLLPPILHSKRDVLFGNMPEIYNFHSRRVIIDS
Download sequence
Identical sequences H2L848
ENSORLP00000002018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]