SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003602 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003602
Domain Number 1 Region: 313-411
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000338
Family DEATH domain, DD 0.019
Further Details:      
 
Domain Number 2 Region: 37-97
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000321
Family TNF receptor-like 0.0015
Further Details:      
 
Domain Number 3 Region: 98-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000326
Family TNF receptor-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003602   Gene: ENSORLG00000002883   Transcript: ENSORLT00000003603
Sequence length 414
Comment pep:known_by_projection chromosome:MEDAKA1:12:3758863:3770025:-1 gene:ENSORLG00000002883 transcript:ENSORLT00000003603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STQVVALFAGLVCHAAEPPASQRSAGVHRNATLRQHQAQCVENQQYPHQGLCCLNCQAVA
GTFVKKPCERDQQQGICEPCEHGQTHTEHSNGMGRCLPCNHCRQDQIEVAACTVTTNTRC
QCKPGTFCAPEQACEVCKRCAKRCKAGEEEVKKCTPFSNTVCQKRGPSSTEPAPVRPSPT
SASASQTHLVLYVFLLLLVAIIVGVAIWWFKGRPSCQTPCKLKPFSVVRREESLSEQRNR
QDSHRKSNFCTAVRSFPALCVTIQYKTMLNSNNEGTSQPRHTLTLKKIPRHTSIQKFFLF
GAVKSAADFLLGPLTRSEKSLRKSFDLFDEYLDVRIHNKFFRLIGISDNHIRIAENGAAA
DKVYELLKNWMQKQGLKADINNLLDALLSLDQRRSAECIAYEALRKGYYRHADV
Download sequence
Identical sequences H2LCG5
ENSORLP00000003602 ENSORLP00000003602 8090.ENSORLP00000003602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]