SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005539 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005539
Domain Number 1 Region: 290-518
Classification Level Classification E-value
Superfamily SIS domain 9.64e-21
Family mono-SIS domain 0.0017
Further Details:      
 
Domain Number 2 Region: 26-174
Classification Level Classification E-value
Superfamily SIS domain 0.00000489
Family mono-SIS domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005539   Gene: ENSORLG00000004413   Transcript: ENSORLT00000005540
Sequence length 582
Comment pep:known_by_projection chromosome:MEDAKA1:2:24524153:24535721:1 gene:ENSORLG00000004413 transcript:ENSORLT00000005540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PATREHPVPTPAWNKSNYEPSLPVSEKSNPFTRDIDRASPSGIVGMLEACDAQMFRQDRG
TNYQRLFDEQVVTTLTEVAKRVELILKDPQDSLVVLSGCGTSGRLAFFMAVKSRFNEALK
QLNRTLVYSYIIAGGDSALLSSQEAPEDDPELGMLSLQKVCEAKKKVLFIGVSCGLSAPF
VAGQLDFCLQHPEVYTPVLLGFNPTHQARDEPIPGCIFTFHSVAQRLQELSQRRKAFLIN
PAVGPEAISGSSRMKGGSATKIVLEVVLSAAHAAAFSHKSVASECILQHMREYERAVEVT
YQQKEGIAAVVEAAGRSLLNEGSVCYLGWGPMAILGLIDASECNPTFGADYTDIRGFIRG
GYKDLNNNEGPLSSLGPEFCIGHEDFLQHVLPGLADKDTVLLIYSQSDDLHEVLNLGRRV
REKTPNLHAVHHRTDSDSAETPQQKSLRLLASFFSWIVFLFPQIPSFYWELSTKLVLNAV
STGAHILKGKVYRNHMIDLQVTNSKLYRRATRLLQTLSGRAESECEEALLKAIYGADKLM
KDIISSDITAHTQVARNAKKVVPSALVSLLTGCALKEVESCL
Download sequence
Identical sequences H2LHS5
8090.ENSORLP00000005539 ENSORLP00000005539 ENSORLP00000005539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]