SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006184 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006184
Domain Number 1 Region: 103-159
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000706
Family TNF receptor-like 0.0033
Further Details:      
 
Domain Number 2 Region: 35-80
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000785
Family TNF receptor-like 0.0036
Further Details:      
 
Domain Number 3 Region: 227-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000647
Family DEATH domain, DD 0.034
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006184
Domain Number - Region: 84-112
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00298
Family TNF receptor-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006184   Gene: ENSORLG00000004915   Transcript: ENSORLT00000006185
Sequence length 408
Comment pep:known_by_projection chromosome:MEDAKA1:16:7180563:7189354:-1 gene:ENSORLG00000004915 transcript:ENSORLT00000006185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEVWPCCYLFTASLSWAHQPQAMPPMYLHKDPVTSELLSCSQCPPGTAVKQHCTKGEATE
CHPCPERQFAENWHWGDTCQYCTSVCKERQLVKQQCNSTHDQICECAPGFHLVVEFCIAH
STCPPGYGVTTLGTPVSDTVCEPCADGYFSVGGSSTDPCRPHRNCSELGLWTLKWGTSTF
NSLCGSPEKRTTLDCSQNHILCHTDVTLCEEAFFQSLASLHLSSVPLERLLDSLPGRRVD
HKSLERLKKACSPQQQVLHLLRMWREQNKDHDKLNGIMQGVNHCERKVSRCNGLKNITFE
DLMKVANSLPRKKVQEVDVLAVFSTCLPRQHILQILHLWKAANSNIDLAKGLSHSLRVLR
SQGAPRYLLKGLKKISRIIETTSTYKMYEKMFVSMLQDEVGQQILRCC
Download sequence
Identical sequences H2LJJ6
ENSORLP00000006184 8090.ENSORLP00000006184 ENSORLP00000006184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]