SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007385 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007385
Domain Number 1 Region: 18-137
Classification Level Classification E-value
Superfamily ISP domain 3.27e-20
Family Ring hydroxylating alpha subunit ISP domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007385   Gene: ENSORLG00000005873   Transcript: ENSORLT00000007386
Sequence length 162
Comment pep:known_by_projection chromosome:MEDAKA1:9:11417182:11418800:1 gene:ENSORLG00000005873 transcript:ENSORLT00000007386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRLSSLSDSPCSSPPNLHYVGKKEEIVKAGRLTKLLNGCRDVLILYHDRQLYAMDKRCY
HSGGELQHGDIEEFNGRLCIVCPWHSYKITLAEGEGLYQAVDDPTKKPPRTHWRSKGVKQ
RIHKVTEINGDVFVTLNKSCEAIESDFYQTEKYRPVTLKGQP
Download sequence
Identical sequences H2LMW2
ENSORLP00000007385 ENSORLP00000007385 8090.ENSORLP00000007385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]