SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007814 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007814
Domain Number 1 Region: 209-307
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-16
Family DEATH domain, DD 0.0034
Further Details:      
 
Domain Number 2 Region: 36-90
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000188
Family TNF receptor-like 0.0068
Further Details:      
 
Domain Number 3 Region: 90-138
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000222
Family TNF receptor-like 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007814
Domain Number - Region: 135-163
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0606
Family TNF receptor-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007814   Gene: ENSORLG00000006217   Transcript: ENSORLT00000007815
Sequence length 310
Comment pep:known_by_projection chromosome:MEDAKA1:15:19391612:19395818:-1 gene:ENSORLG00000006217 transcript:ENSORLT00000007815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTGLKNVWIYFLLLAIGTLVPSTSANIQVPNAGVCADGNYTHDGKTCCLCAPGQRVLK
HCTDSPTNGECVFCEEGKTYREEPNSQTTCELCDSCSHPNANLEVVERCTTSRNAKCGCQ
KGYYCDSEKGSCVVCQSCDICESTGIKIACNGTSNTVCNESQGISGGAIAGIVIVIILAI
LAAGVVLWWKKTRKPSDGAEPDSEELEYLNEVDIKPHLADIAQILGWKDMLYIARKSKML
DTTIDSCQLNHPNDTEESTVELLQKWSEIKGRTGVRSLVQMLNASRKQDKKERILKLIKN
DTNNECSNPV
Download sequence
Identical sequences H2LP34
ENSORLP00000007814 XP_004077397.1.28442 ENSORLP00000007814 8090.ENSORLP00000007814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]