SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007938 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007938
Domain Number 1 Region: 93-355
Classification Level Classification E-value
Superfamily Caspase-like 1.41e-58
Family Caspase catalytic domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000316
Family Caspase recruitment domain, CARD 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007938   Gene: ENSORLG00000006320   Transcript: ENSORLT00000007939
Sequence length 362
Comment pep:known_by_projection chromosome:MEDAKA1:13:13125855:13128202:1 gene:ENSORLG00000006320 transcript:ENSORLT00000007939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQDKVLNDEERESICEEKSRADMARSLIDTVRKKGSTASKMMINHFEQKDPILFSELG
LSCPEPAQTNSHSQRDEPATTVLTAEDFWKKTQNDPNVYPVTKASYKSRVALMITNIKFS
NEKLNRAGAEKDEENMDRLLSKLGYEVVKHKSLTGKAINEAFIEFTKHPKLKETDSVIVV
LMSHGKLGAVLGVEWKHDDENPDEFPVNSIYEHLGPEKCPALLDKPKIIIIQACRGDQTG
SVCISDSGNQAEEFLHPAAAGDLLEDNLRFVHKEKDFISLLSCTPDTKAFRCRARGSHLI
QYIVEIFNTDADTLYIQELFRKVMLRFESFAFKHNRQMATIERCTLLKQFYFYPGLGDTN
HS
Download sequence
Identical sequences H2LPF5
ENSORLP00000007938 8090.ENSORLP00000007938 ENSORLP00000007938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]