SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007975 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007975
Domain Number 1 Region: 290-379
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 8.89e-30
Family Small-conductance potassium channel 0.00011
Further Details:      
 
Domain Number 2 Region: 156-326
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-22
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007975   Gene: ENSORLG00000006347   Transcript: ENSORLT00000007976
Sequence length 441
Comment pep:known_by_projection chromosome:MEDAKA1:16:11727650:11742729:1 gene:ENSORLG00000006347 transcript:ENSORLT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGHNLYRLRDRKLLIEDKKRLCALALGAALLGILLMIIHAEICPHVYKPGSKVSMIINC
FISLSTGCLLVLIIAFHYKDIRLFIFDHNQVDWRIAMTSHRVIVIILELLVCGIHPVGSY
WEVGLHVNSSSAAPSCISSHHNKALQDMELLLSMLMFLRLYLVHRAILLHSKELLSASYR
SIGSLNNINFTFRFVLKVLMNKHPTRTLLVFILLFWLTVSWMLTLCERRIHEPAGAGQMD
TALWLIAITFLTVGYGDVAPKTSCGKGVCLFTGVMGVACTAMLVATVTEKLALNKGEKHV
HFFMMDIQISKRQIRHAAANVLRECWLLHRTSLTRASHGQHRRHQRCLLEAIRVFRHLRL
QQRKLRDYVSEMVDLPKMQMIMCDLSANWNNSYRELEQRILSMEQKLDELTRCFQQTSEL
LSDVLHRHHSPEESHPTGGAA
Download sequence
Identical sequences H2LPJ2
ENSORLP00000007975 ENSORLP00000007975 8090.ENSORLP00000007975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]