SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007977 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007977
Domain Number 1 Region: 246-334
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 9.29e-32
Family Small-conductance potassium channel 0.0001
Further Details:      
 
Domain Number 2 Region: 112-285
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-24
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007977   Gene: ENSORLG00000006347   Transcript: ENSORLT00000007978
Sequence length 382
Comment pep:known_by_projection chromosome:MEDAKA1:16:11730727:11742507:1 gene:ENSORLG00000006347 transcript:ENSORLT00000007978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEFIVKGSKVSMIINCFISLSTGCLLVLIIAFHYKDIRLFIFDHNQVDWRIAMTSHRVIV
IILELLVCGIHPVGSYWEVGLHVNSSSAAPSCISSHHNKALQDMELLLSMLMFLRLYLVH
RAILLHSKELLSASYRSIGSLNNINFTFRFVLKVLMNKHPTRTLLVFILLFWLTVSWMLT
LCERRIHEPAGAGQMDTALWLIAITFLTVGYGDVAPKTSCGKGVCLFTGVMGVACTAMLV
ATVTEKLALNKGEKHVHFFMMDIQISKRIRHAAANVLRECWLLHRTSLTRASHGQHRRHQ
RCLLEAIRVFRHLRLQQRKLRDYVSEMVDLPKMQMIMCDLSANWNNSYRELEQRILSMEQ
KLDELTRCFQQTSELLSDVLHR
Download sequence
Identical sequences H2LPJ3
ENSORLP00000007977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]