SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008143 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008143
Domain Number 1 Region: 411-814
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-136
Family Ankyrin repeat 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 114-429
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.36e-99
Family Ankyrin repeat 0.000000581
Further Details:      
 
Domain Number 3 Region: 1425-1507
Classification Level Classification E-value
Superfamily DEATH domain 1.01e-21
Family DEATH domain, DD 0.0041
Further Details:      
 
Domain Number 4 Region: 19-113
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-20
Family Ankyrin repeat 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008143   Gene: ENSORLG00000006482   Transcript: ENSORLT00000008144
Sequence length 1892
Comment pep:known_by_projection chromosome:MEDAKA1:9:11938109:11969788:1 gene:ENSORLG00000006482 transcript:ENSORLT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVLPRGSHSAARADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEG
HVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQRQKGFTP
LYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRL
PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNF
TPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHFRIIEILLDN
GAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMA
KVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFM
GHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPL
HCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTK
KGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGS
PHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLL
ISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNI
KMVKFLLQQQANVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHDAQPNEITTHGTSALAIA
KRLGYISVIDVLKLVTEETVSMTTTEKHRMSFPETVDEILDVSEDEGIAQLTLEGEELLG
TEGARYMKMDDMKDHDADFLSPKKSLENYSPAIPRIPRVSPETVILKEQEITQQHTPLPL
PKEYDEDSLIPSSPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPP
RTCAAPTRITCRLVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALG
RGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGMDEELESQEELGKKRIRRIISTDFP
LYFAVVSRVQQESDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAK
LLGNQANFSPVVTVEPRRRKFHRPIGLRIPLPPSWRDSPRDSGEGDTTSLRLLCSVIGGT
ASAQWEDITGTTKLIYANDCASFTTNVSARFWLADCPRTAEAVSFANLLYRELSAVPYMA
KFVVFAKMNELREGRLRCYCMTDDKMDKTLEQHENFAEVARSRDIEVMEGMPLHLECSGN
LLPVRKATQQPRCFSFQAFRDNRLPVTVKVRDSSKEPTGFLSFLRKSTKYEDSQHVLCNL
NITMPPCITMRGSEDRRRTLTPLALRERYNALNEPAMASMSAMERTELKMAVIAEQLGLS
WAELARELQLSVDDINKIRVENPNSLLEQSSALLNLWATREGKRAKMESLYTALKSIDRM
DIINMLEGPPAQPERQGSRDFSRRCHGREHLSPGMTNGYGLGQEELLSPASMQYSLPSPL
EAEPYWQEVSSLDCAPIATTEEDTLMEMSDVQVWPSGNSPSLVPVEDSSLECSNADDSEG
LLGLPRGSLGRPASQASAASGGGGILSGSIELPEDDSEGSEASSELSAVTNTTGGEGAGG
GGGREGGAGSEEGLSLVAGQQRVYARLSESPGLSCVADRNGDSDPTQAWVGIQSKSRHVM
DTMISSVHNSVDGDPSHVSQEALLQPVRDMGHSEILRGQFRGTQPFEKGLGFPHRVPELR
AWDDENSFQLEQEGDEVEDLPGEQVSEEQFTDEHGNIVTKKIVRKVVRRGKGSGEEGVQE
HDNIFLKGQSDSVDVKKGAQIVKCASLRRVKQ
Download sequence
Identical sequences H2LQ07
ENSORLP00000008143 8090.ENSORLP00000008143 ENSORLP00000008143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]