SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008481 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008481
Domain Number 1 Region: 822-906
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-21
Family DEATH domain, DD 0.00011
Further Details:      
 
Domain Number 2 Region: 155-245
Classification Level Classification E-value
Superfamily Immunoglobulin 7.39e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 4 Region: 299-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000392
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 5 Region: 48-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000428
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008481   Gene: ENSORLG00000006750   Transcript: ENSORLT00000008482
Sequence length 912
Comment pep:known_by_projection chromosome:MEDAKA1:10:15622665:15695323:1 gene:ENSORLG00000006750 transcript:ENSORLT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSYRGARGAAKSFLFMCHWRKSNNSKNVKSSEYAATAALPAAFSDRLPHFLVEPEDKYIV
KNKPVTLTCRSTPATQIYFKCNGEWVHQDDHYIEHSVDPATGLPVMWVTIDITRQQVEKI
FGLDEYWCQCVAWSTTGTQKSQKAYIRIAYLRKNFEEEPQSKEVALDQEVSLRCHPPEGV
PPAEVEWQRNEDLVDPTSDPNFVITPDHNLVIKAARLADTGNYTCVAKNIVARRKSNSAT
VLVFVNGGWSTWTTWSSCSAVCGRGWQKRSRSCTNPTPLNGGTSCEGQNVQKSACVATCP
VDGGWSEWSKWSACGADCSMWRSRECTQPSPGTGGKDCQGLDLQSLNCTSEQCPQICTSL
NVQQLRAVRGAEDVALYVGMVAVALCLTLLLIVVVLVYRRKKEGLDADVADSSILTTGFQ
PMGIKPSKPENSHLLTIQPDLTTTTTSYQGTLRSRHDATAKFSMTNGPLLDPLPNGSHTL
HNGKLNPDPAEFVSRFSTQSYFKTLPRDVANTSYGTFNFLGGRLTIPNTGISLLIPPEAI
PRGKIYEIYLTVQRKEDLRLPLAGCQTLLSPVVSCGPPGVVLSRPVILSMDHCFDACLDN
WAVRLKKQNYEGTWEDVLLMGEELVSEPFYCQLEAETCRLFSEQLGTFAVVGESLHMGAA
KRLRLVLFSDAYCSTLEYNIRVYCMDDTQDVFKEVMQMERQLGGRLIDEPHVLLFKDSYH
NLRLSIHDMPQAHWRSKLLAGYQEIPFYHIWNGSQRYLHCTFTLERLSLSTCELTCQLCV
WQVEGEGQSFSLDFNIAKDTRAVDSEFLVMDSNATALAGPSAFQIPYLIRQKICSSLDAP
CPNGADWRMLAQRLKLERHMSFFASKASPTSGILDLWEAQHFHSGNINQLAAVMADIGKQ
EAMIFLVSDGDC
Download sequence
Identical sequences H2LQY6
8090.ENSORLP00000008481 ENSORLP00000008481 ENSORLP00000008481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]