SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008935 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008935
Domain Number 1 Region: 180-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-16
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008935   Gene: ENSORLG00000007123   Transcript: ENSORLT00000008936
Sequence length 236
Comment pep:novel chromosome:MEDAKA1:17:11509315:11511721:-1 gene:ENSORLG00000007123 transcript:ENSORLT00000008936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVQSLREFISERLTAAAEEIFRQFEKTIVQYEEEIMDRQHRLLDNCSSWKRNTNNIAD
IPAFICKEFVVNPLSLNHQKGPEEPELKWIKEEQPQLGCSQDWKQLGSETEVDLSAQMFS
GSEIEPKAAQLHFLDSLLIESQGPDLESAKNLEIKEEMSTYGESSSSSSFCLNDTSSNKS
VNCEICGKTLKDKYSMKQHLRIHSGVRPYICRTCGKGFTQKGNLLSHVRIHAGEKL
Download sequence
Identical sequences H2LS74
ENSORLP00000008935 8090.ENSORLP00000008935 ENSORLP00000008935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]