SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010513 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010513
Domain Number 1 Region: 151-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010513
Domain Number - Region: 200-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00389
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010513   Gene: ENSORLG00000008372   Transcript: ENSORLT00000010514
Sequence length 240
Comment pep:known_by_projection chromosome:MEDAKA1:17:13941628:13945618:-1 gene:ENSORLG00000008372 transcript:ENSORLT00000010514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLATSPDYFAAECLVSISSGPVLHRPTPVAPVSQPAAPGLSFGEPDGSNEDREVRETLK
LEGTNLMTVASILTDLHSKFRPMSAYSESSNSSCGGESGYTTLSDPTTPTMTPSATPVPG
QQQWGSAGGAGLPRSPGKRHQCTFDGCDRVYGKSSHLKAHIRTHTGERPFPCTWPDCEKK
FARSDELTRHTRTHTGEKRFACPLCSKRFMRSDHLKKHAHRHPNFKPHMLKQNRGAPGDS
Download sequence
Identical sequences H2LWM2
8090.ENSORLP00000010513 ENSORLP00000010513 ENSORLP00000010513 XP_004078938.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]