SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011023 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011023
Domain Number 1 Region: 368-462
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.02e-36
Family Small-conductance potassium channel 0.00000345
Further Details:      
 
Domain Number 2 Region: 237-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.2e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011023   Gene: ENSORLG00000008777   Transcript: ENSORLT00000011024
Sequence length 561
Comment pep:known_by_projection chromosome:MEDAKA1:17:14498199:14544202:-1 gene:ENSORLG00000008777 transcript:ENSORLT00000011024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTCKYNGGVVRPLVGSLASSSRRNLAELDSETQPLQTLHSSGLEVVVSKGNSGEDPSKA
SNESLVREGSGRGGGRAPQKKNRDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTE
TELSWGVYTKSTVSEHVYVFDLRCVFVSLYVFFPFGLIIMYHAREIQLFMVDNGADDWRI
AMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLY
LIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAW
TVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTA
LVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAK
VRKHQRKFLQAIHQAQKLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELD
KRIGTLEDKLDSVTGSLQALPCLISQAISQQQQDFLDGFVHRFRPASLASERSERSERSW
TSTTRRRRSPSTAPHTSSDSG
Download sequence
Identical sequences H2LY11
ENSORLP00000011023 8090.ENSORLP00000011023 ENSORLP00000011023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]