SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011233 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011233
Domain Number 1 Region: 706-922
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-103
Family Thrombospondin C-terminal domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 583-704
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.7e-32
Family TSP type-3 repeat 0.00000491
Further Details:      
 
Domain Number 3 Region: 515-585
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000392
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 438-526
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000379
Family TSP type-3 repeat 0.00011
Further Details:      
 
Domain Number 5 Region: 222-257
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000144
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 6 Region: 53-149
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000302
Family Laminin G-like module 0.033
Further Details:      
 
Domain Number 7 Region: 267-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.028
Further Details:      
 
Domain Number 8 Region: 350-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000982
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011233
Domain Number - Region: 412-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0635
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011233   Gene: ENSORLG00000008957   Transcript: ENSORLT00000011234
Sequence length 929
Comment pep:known_by_projection chromosome:MEDAKA1:9:13489552:13498466:-1 gene:ENSORLG00000008957 transcript:ENSORLT00000011234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGMCGRAVALSLVLQQLVLTVTAQGIVYDLLVSPDCLPDLLQGSLKNKGRDEAFLLSSF
RLFNKAPTSLFSVYNPKDNNKYLDLSVQAKLNKVTLRYQKTDGRFGTTSFNHPTLADGQV
HHVMLHARGLQRGPPRLDMYVDCRLVHTLNDLPAAFGSLPPGPNKVALRTLQSGGQDNLT
DLKLVIDDSRENVATLQECIMEPESLHLLGIQGGRVVQDQVTMLELKAMVSEMRELLHNQ
IKETNFLRNTIAECLACVMQPQPLTQCPPGTCFRQNMCIPTVSGGFQCAPCPDGFTGDGV
NCDDVDECQFNPCFPGVRCVNTAPGFRCEKCPLGYVGAEIDGVGVSYAKSHKQVCEDVDE
CLGPPLNGGCTANSHCYNTVGSFRCGDCKTGFTGDQIRGCHGSRLCPNGQPSPCDIHGEC
IVERDGSISCVCGVGWAGNGYVCGQDTDIDAYPDNKLLCTDNSCKKDNCLYIPNSGQEDA
DRDGMGDACDHDADSDGIINEDDNCWLVPNVDQKNTDKDVHGDACDNCKHVENPSQKDTD
KDGLGDECDDDIDGDGLKNILDNCQKVPNPDQRDKDNDGVGDACDSCPDVANPNQSDSDD
DLIGDTCDDNIDSDGDGHQNTKDNCPDVINSSQLDTDKDGMGDECDDDDDNDGIPDTEDN
CRLVANRDQKDSDMDKVGDACQGDFDKDNVIDRIDHCPENAEVTLTDFRAYQTVVLDPEG
ESQIDPNWVVLNQQGMEIVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFIFG
YQDSSSFYVVMWKQTEQTYWQASPFRAVAEPGIQLKVVKSRTGPGEYMRNSLWHTGNTTD
QVQLLWKDPRNVGWKDKVSYRWFLQHRPQVGYIRARFYEGSELVADTGVIIDTSMRGGRL
GVFCFSQENIIWSNLKYRCNDNIPEDYQD
Download sequence
Identical sequences H2LYL4
8090.ENSORLP00000011233 ENSORLP00000011233 ENSORLP00000011233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]