SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011736 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011736
Domain Number 1 Region: 16-237
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-49
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 521-823
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000785
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 3 Region: 249-327,420-476
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000851
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011736   Gene: ENSORLG00000009359   Transcript: ENSORLT00000011737
Sequence length 919
Comment pep:known_by_projection chromosome:MEDAKA1:23:2067316:2105181:-1 gene:ENSORLG00000009359 transcript:ENSORLT00000011737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDTGYLDVSICELKHPPAVLCPMPEGLSSQQVIRRLILSSIVQSESSYLDSLKRILQEYQ
KPLLESHTSILNPEKVHQIFFRLREIHQCHSMFQIALASRVADWDQSEMIGDLFVASFSK
SMVQSVYRDYINNFTKAMALIKKACVSRPAFLDFLKMKQASSADRITLYGLMVKPIQRFP
QFILLLQDMLKNTPLAHKDRLPLQLALTELEILAEKLNEERRLADQEAEIQQLAHSIGDR
NLNKLLNSEQRQLIHSELLTETVYGDKGQVLKSKKRKVFLFSDSLICANINWKGPPEISS
LVPLGAKCSVKWCAPVAQIQVEEVGQDGVVISRRHSSASTTTGSGKSNCLFAGRLFLGPP
RLFQELEELQHDLAVVEEVSLLVGTLHGLYQNLNSTVSQDWCCALQRLIRLKEEQIQDAN
KCCLRLSIPSRPDRSGRPVSIMVVFNTLSPHSKISWVNRIYLAKLAQRKENSPGWECYED
DCKTQTLFGSPLLTCSLPVLSSRTLSLTLKAALHSPSQSTLLGLCSTTTCLPQGYLWVAG
GGGGSLHGQVDIFSLNRTTPRLVKSIPLRSPVLCLELVREPGPRTDEEEEEKESGRVTRA
ENIICVGLQDGSIHVHSSVDTAVETLQTLVNPDSCPVLCLKHSTSFLFAGLANGKVAVFQ
RAAGEMLWDADSCRLVLLGSEPVHALLTVEDAVWASCGHHVSVIQGEGLHTQQVLEVHHD
PGCRVRCMVRSGAGVWMAFTKGSSIYLFHTETLEALQEVNISARSRHPGRSQLTVSCMLI
CQGLLWVGTNQGVILTFPVPTLEGIPRITGKGRASLNAHCGPVDFLVSASRTLVPDFLSR
GPVLSSSQDGEASLGVDERADKHSSSQDPEAPPWKGLLLQYRVTSSCQLPGKLLSAQPEE
DGARTPPDQPEHRPEDGSI
Download sequence
Identical sequences H2M013
ENSORLP00000011736 ENSORLP00000011736 8090.ENSORLP00000011736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]