SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011743 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011743
Domain Number 1 Region: 75-394
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.27e-95
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.00000000576
Further Details:      
 
Domain Number 2 Region: 400-502
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 6.28e-25
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011743   Gene: ENSORLG00000009364   Transcript: ENSORLT00000011744
Sequence length 821
Comment pep:known_by_projection chromosome:MEDAKA1:9:13658055:13663813:1 gene:ENSORLG00000009364 transcript:ENSORLT00000011744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNEPAQTKDEGFLSRMALNDNKAGMEGLDRDKINNIIMESSKGSKFYENELKKDQQVNQ
RIEKMMLQKANITQAQLKKAQAQVEKMALALERSRDLSRVIVHVDMDAFYAAVEMRDCAE
LKTKPMAVGSMSMLSTSNYLARKYGVRAAMPGFIAKKLCSDLVIVPPNFDKYRAVSDEIR
EIFADYDPDFLPMSLDEAYLDFTEHLEQRQTWPESLRTHRYSSKSITTAVKETPNPKDTE
AKDEDLSPILFNESPGSPPGLDGSKGANGGSELFGTSVEEAVREMRFRIEQKTMLTASAG
IAPNMMLAKVCSDKNKPNGQYRLPPTREAVMDFIQDLPVRKVCGIGKVSEKMLNALEITK
CSHLGQQMALLSLLFSETACQNFMEVSLGLGSTRISRHEERKSMSIERTFKELSDAEEQY
SLCRELCKDLAEDMKKEGLKGKTVSLKLKNVNFEVKTRAQTLQCAVAAEEELFAVAKDLL
KTEIDNESPHPLKLRLMGVRMSAFVSSDHKAPTQKSILGFLKSGSSGSSEQAQAKRLQLH
VSSVNTQDEGRGAEARGISPIGACSKESALSSAALNKTGGSVSQMLENKRAAPAGDHPST
SGCEARPQILICPVCSSKVETTDLNVFNRHIDLCLNVASTNPKKNESESVYDEEKCLQDQ
ECKELNKRKERSEAEEEQPFGSKESSRVCPRGGQHGGSIQKVFLTQSDSKPTTSQKCQGK
RSDLVCPVCHLTQETDDLAVFNRHVDLCLNQEVLHELKGQTTFSQNPSVVKNSKNIGKSP
NYGSKLIISAFFSLRRGSPSSLPSKKSRSLGLCNTIDKFLR
Download sequence
Identical sequences H2M020
ENSORLP00000011743 8090.ENSORLP00000011743 ENSORLP00000011743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]