SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012280 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012280
Domain Number 1 Region: 144-286
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.23e-27
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 4-112
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-23
Family DEATH domain, DD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012280   Gene: ENSORLG00000009788   Transcript: ENSORLT00000012281
Sequence length 288
Comment pep:known_by_projection chromosome:MEDAKA1:20:16396073:16398623:1 gene:ENSORLG00000009788 transcript:ENSORLT00000012281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCSSDVDLWTVPLVALNVTVRRKLGLYLNPKNTVAADWMTVAEEMGFTYLEIKNYEAS
KNPTKTVLEDWQARSKDASVGKLLSILTEVERKDVVEDLRPQIDEDVRKYLESLQRKSEP
PLQVAEVDSCVPRTPERFGITVEDDPDGSPEMFDAFICYCQDDFHFVCEMIRELEQTDHK
LKLCVFDRDVLPGSCVWTITSELIEKRCKRMVVVISDEYLESDACDFQTKFALSLCPGAR
NKRLIPVIYKTMKKPFPTILRFLTVCDYTKPCTQAWFWIRLAKALSLP
Download sequence
Identical sequences H2M1J7
8090.ENSORLP00000012280 ENSORLP00000012280 ENSORLP00000012280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]