SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012390 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012390
Domain Number 1 Region: 194-318
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.57e-57
Family Dystroglycan, domain 2 0.00000227
Further Details:      
 
Domain Number 2 Region: 475-574
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000832
Family Dystroglycan, N-terminal domain 0.023
Further Details:      
 
Domain Number 3 Region: 77-173
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000204
Family Dystroglycan, N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012390   Gene: ENSORLG00000009878   Transcript: ENSORLT00000012391
Sequence length 868
Comment pep:known_by_projection chromosome:MEDAKA1:7:16536565:16539998:-1 gene:ENSORLG00000009878 transcript:ENSORLT00000012391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHYKQRDMSCGNVRRSRLLSCRTLLLVIGLLVTIARDTVADQQGTKVDMLPVELEASMQS
SVLSELQAAASSTEGAHTNIPDSSAIVGQVFQLKLPPGKTHASCNVHKLTELGKKSLPSW
LCWDKESCSLKGLALDRDKGSYRILVSEEGLAENTSSQVYPSTVFSIEVYPEDRADTEPA
LFTLQSDSSLQPFTCMSEEPVTVLTVILDADLTKMVAKQRVNLLSVMKKFSHVPLEHMRV
VPVVNNRLFDMTAFMAGPGNAKKVIENGALLSWKVGCSLDHDSIPDISSVQYSAKDGTMS
AKLGYPVVGWHIVNKKTHVVKRVRRHLNNTPTPVPSLLPPTVSQEPLSRPVPTPISPFIA
PATDISAPPVRGPLPLPVKPTMRVRDQIAHTPVFGPPQPTRVLGTTSTLPIQPATTRPTI
AEPTAMPTAPSTTKKPKPSSTKKPKKSKSSTPAPRQPKSTTVKTPKIRIESNTTPVIRNS
IDHVIAWVGTYFELKIAADTYYDIEDGTTDKLRLTLLKSSKEPVSETSWIQFNSTIQLLY
GLPEDEGNHEYFMMATDKGGQSIMDAFVVQVNRWSNNDKPSVMFAARFEGDHKSLNGDVN
KKILLIKKLAYAFGDRNSSTVTLRNIRSGSIVVQWTNNSLQQNPCPKDQITVLSNRISDS
QGKPKPAFIKAMEPEFITINISVFGTNECQRYTFIPPGEIPVPILPTPSPSPGTDRRSSD
DVYLHTVIPAVVVAALLLIAGIIAMVCYRKKRKGKMTTEEQATFIKKGVPIIFADELDDS
KSPPSSSIPLILQEEKPPLPPPEYPNMPGPHSSLLNQDLMEDFLIYQDDDPNAPPYQPPP
PFTVPIEGKGSRPKNMTAYRSPPPYVPP
Download sequence
Identical sequences H2M1V5
ENSORLP00000012390 8090.ENSORLP00000012390 ENSORLP00000012390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]