SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012518 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012518
Domain Number 1 Region: 528-619
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.14e-41
Family Small-conductance potassium channel 0.00000396
Further Details:      
 
Domain Number 2 Region: 397-569
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012518   Gene: ENSORLG00000009976   Transcript: ENSORLT00000012519
Sequence length 729
Comment pep:known_by_projection chromosome:MEDAKA1:16:15575674:15651938:1 gene:ENSORLG00000009976 transcript:ENSORLT00000012519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPASLPKLPLSSSGTQPLPTPIPNALHPTSTPLSSCLGSQHSLSGENSPVYNALFYSSH
SPSMEREKDRERDRDRGSKHRQASPLVHRRDSNPFTEIAMSSCKYTGGVMKPLSRLSASR
RNLIESESSSETKEGAVSAVAGLSVAGGHDRQRDAPSACSVTQSSTNQLLIQTPPEIVIS
SKEDSTYPRGGYDITDSSSNQMSIYHQNHALVESRRVQPGRGSRQAGVGAASTGARGSTS
KASKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVYSKSSMYS
LALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVH
PVPGDFKFQWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRS
IGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLG
AMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVH
NFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKM
EQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFNALPAH
LSATLSAQHAALVQLLRERDARDSRGGGAVLPLSPAASVTKSPLSPPPPLSPDGSLEASP
KPNSCTSSC
Download sequence
Identical sequences H2M279
ENSORLP00000012518 8090.ENSORLP00000012518 ENSORLP00000012518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]