SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012520 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012520
Domain Number 1 Region: 399-490
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.09e-41
Family Small-conductance potassium channel 0.00000396
Further Details:      
 
Domain Number 2 Region: 268-440
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.14e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012520   Gene: ENSORLG00000009976   Transcript: ENSORLT00000012521
Sequence length 549
Comment pep:known_by_projection chromosome:MEDAKA1:16:15575971:15651704:1 gene:ENSORLG00000009976 transcript:ENSORLT00000012521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSCKYTGGVMKPLSRLSASRRNLIESESSSETKEGAVSAVAGLSVAGGHDRQRDAPSAC
SVTQSSTNQLLIQTPPEINHALVESRRVQPGRGSRQAGVGAASTGARGSTSKASKRKNQN
IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVYSKSSMYSLALKCLISL
STVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQ
WRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHF
NTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITF
LSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLT
KRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQA
NTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFNALPAHLSATLSAQH
AALVQLLRE
Download sequence
Identical sequences H2M281
ENSORLP00000012520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]