SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013777 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013777
Domain Number 1 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.67e-16
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 287-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000856
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013777   Gene: ENSORLG00000010985   Transcript: ENSORLT00000013778
Sequence length 418
Comment pep:known chromosome:MEDAKA1:9:16729943:16733650:1 gene:ENSORLG00000010985 transcript:ENSORLT00000013778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKLADKIPLTMSSLINTIPDSLYPEEDIPTSMNIFTNTESINHYSQMNTDNIMDLGMG
SEKATSEIQYGSSFQSSRSGQTVTYLGKFAFDTPPSGGIGGSGWCPDNNIISLVSAGILG
VSPSPGNVTTQTSSSGASMGGQAADMEQVYGPPLPPYSTCSDLYQDQGSFHHSPVSSTAL
AYPGNDYHSTPKASMDGSLFSMIPDYNLFHHQGEVGVMEHKPFQTMDPIRVNPPPITPLE
TIRAFKDKQQMHPCFPGGQQHPPQHHPPPQTLTLKPIRPRKYPNRPSKTPVHERPHACPA
ENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCG
RKFARSDERKRHAKVHLKQKDKKQAEKSSGVAGSHTSPPNSCGGPTQFRASATVTRCQ
Download sequence
Identical sequences H2M5P5
ENSORLP00000013777 8090.ENSORLP00000013777 ENSORLP00000013777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]