SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014046 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014046
Domain Number 1 Region: 227-477
Classification Level Classification E-value
Superfamily Caspase-like 3.74e-69
Family Caspase catalytic domain 0.00000402
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-19
Family DEATH effector domain, DED 0.004
Further Details:      
 
Domain Number 3 Region: 90-186
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-19
Family DEATH effector domain, DED 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014046   Gene: ENSORLG00000011198   Transcript: ENSORLT00000014047
Sequence length 481
Comment pep:known chromosome:MEDAKA1:17:17409918:17415919:1 gene:ENSORLG00000011198 transcript:ENSORLT00000014047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRTLSRIDDELNSEEVAELCFLCTDFIPRKRLEGISSAKDLFLKLEDATLLDSSYLTQ
LFRTIHREDLVRQVQNGSRQAEEADAVPSLSDYRVMLYSIHDDMTEENLDKLKFLLNPKL
NRRPLEKSKTALDVFVEMEKSQLISKDDVSGLYKLLLEFDKKLAAVVEKYMQDHRGALTD
TSHYQKRPSIPSLESLSVSQPETWSETEDPNNGVRSDATPCPDPPTSPDEEEYYSFTHEP
RGLCVIFNNKLFFPESNLGERGGTEKDEKSLNNLFHRFGFEVVVHNNLTADLIESEITKL
GQRNFSHDDALVVCVLSHGDNGCVYGIDGKKVQLRALTLPFTSYRAPSLIGKPKLFFIQA
CQGTLDQSGYLPGSEVKGDAELEADASSSTSNSVPNDADFLLGMATVAECKSFRNKYTGS
IYIQELCRQLERAAESSKMEDILGVLVHVNREVSKGVFLNKKQMPEPKYTLTKKVVLKYM
N
Download sequence
Identical sequences H2M6F2
ENSORLP00000014046 8090.ENSORLP00000014046 ENSORLP00000014046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]